General Information

  • ID:  hor001349
  • Uniprot ID:  Q6IGX9
  • Protein name:  SIFamide
  • Gene name:  SIFa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Strongly expressed in two pairs of neurons in the pars intercerebralis (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007610 behavior; GO:0007621 negative regulation of female receptivity; GO:0042752 regulation of circadian rhythm; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0048047 mating behavior, sex discrimination
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AYRKPPFNGSIF
  • Length:  12(27-38)
  • Propeptide:  MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK
  • Signal peptide:  MALRFTLTLLLVTILVAAILLGSSEA
  • Modification:  T12 Phenylalanine amide
  • Glycosylation:  T8 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Ligand for the neuropeptide SIFamide receptor (PubMed:16378592). Modulates sexual behavior by negatively regulating female receptivity to male courtship and by playing a role in male sex discrimination (PubMed:17126293, PubMed:26469541). Also involved in
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SIFaR
  • Target Unid:  Q8IN35
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6IGX9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001349_AF2.pdbhor001349_ESM.pdb

Physical Information

Mass: 159298 Formula: C67H97N17O16
Absent amino acids: CDEHLMQTVW Common amino acids: FP
pI: 10.45 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -47.5 Boman Index: -1702
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.83
Instability Index: 836.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  20575072
  • Title:  Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits.